Logo
  • 0
    • Sign In
    • Sign Up
  • 0 My cart AED0.00
    Shopping cart
    Cart

    Your Cart is Empty!

×
  • Beauty & Personal Care

    Makeup

    • Makeup Brushes
    • Hair Style Spray
    • Foundation
    • Makeup Sponges
    • Face and Body Gems
    • Concealer
    • Face Powder
    • Blush

    Skin Care

    • Scrub
    • Facial Peels
    • Moisturizer
    • Toner
    • Cleanser
    • Moisturizers and creams
    • Cream
    • Serums and treatments

    Sustainable and Natural Products

    • Organic skincare
    • Natural hair care
    • Eco-friendly packaging
    • Cruelty-free products

    Fragrances

    • Perfumes
    • Colognes
    • Body sprays
    • Perfume Rollerballs
    Beauty & Personal Care
  • Women's Fashion

    Bottoms

    • Jeans
    • Skirts
    • Shorts
    • Leggings

    Tops

    • Tops
    • Blouses
    • Dresses
    • Women's T-shirts
    • Tank tops
    • Crop tops
    • Intimates

    Women`s Accessories

    • Women`s Hand Bags
    • Scarves
    • Women`s Back Bags
    • Hats
    • Belts
    • Gloves
    • Sunglasses

    Dresses

    • Casual dresses
    • Evening gowns
    • Cocktail dresses
    • Cardigans
    • Maxi dresses
    Women's Fashion
  • Men's Fashion

    Men's Tops

    • T-shirts
    • Polo shirts
    • Dress shirts
    • Henley shirts

    Men's Bottoms

    • Jeans
    • Chinos
    • Shorts
    • Dress pants

    Men's Bags

    • Backpacks
    • Messenger bags
    • Duffel Bags
    • Briefcases

    Men's Outerwear

    • Men's Jackets
    • Coats
    • Blazers
    • Vests
    Men's  Fashion
  • Health & Household

    Vitamins & Supplements

    • Testosterone Booster
    • Multivitamins
    • Herbal Supplements
    • Probiotics
    • Omega-3 & Fish Oil
    • Calcium & Vitamin D
    • Immune Support
    • Energy & Endurance

    First Aid Supplies

    • First Aid Kit
    • Bandages & Dressings
    • Antiseptics & Ointments
    • Pain Relief Medication
    • Gauze & Pads
    • Medical Tape
    • Splints & Supports
    • Thermometers

    Masks

    Health & Household
  • Pets

    Pet Toys

    • Chew Toys
    • Interactive Toys
    • Fetch Toys
    • Catnip Toys
    • Puzzle Toys

    Pet Carriers and Travel

    • Flea and Tick Prevention
    • Pet Carriers
    • Travel Crates
    • Car Seat Covers
    • Travel Water Bowls
    • Pet Travel Bags

    Pet Housing

    • Dog Houses
    • Cat Trees and Scratching Posts
    • Hamster Cages
    • Bird Cages

    Pet Feeding Accessories

    • Food and Water Bowls
    • Automatic Feeders
    • Rabbit Hutches
    • Water Dispensers
    • Elevated Feeders
    • Food Storage Containers
    Pets
  • Tools & Home Improvement

    Hardware Tools

    • Screws and Nails
    • Bolts and Nuts
    • Hinges
    • Hooks and Brackets
    • Anchors

    Paint and Supplies

    • Paint Brushes
    • Rollers
    • Paint Sprayers
    • Paint Trays
    • Painter's Tape

    Building Supplies

    • Lumber
    • Drywall
    • Concrete and Cement
    • Insulation
    • Roofing Materials

    Outdoor Power Equipment

    • Lawn Mowers
    • Leaf Blowers
    • Hedge Trimmers
    • Chainsaws
    • Pressure Washers
    Tools & Home Improvement
  • Kid & Baby

    Clothing

    • Baby Onesies
    • Boys 2pcs
    • Baby and Toddler Pants
    • Baby Dresses
    • Baby and Toddler Socks
    • Hats and Headwear
    • Baby Shoes

    Sleepwear

    • Eyes Mask
    • Toddler Shirts and Tops
    • Pajama Sets
    • Nightgowns
    • Sleep Shirts
    • Sleep Rompers
    • Sleep Sacks
    • Loungewear

    Outdoor Games & Entertainment

    Kids' Bed Sets

    • Bedding Sets
    • Themed Bed Sets
    • Convertible Bed Sets
    • Comforter Sets
    • Duvet Covers
    • Sheet Sets
    • Pillow Sets
    • Blankets and Throws
    Kid & Baby
  • Home Decorations

    Bed Sets

    • Comforter Sets
    • Luxury Bed Sets
    • Seasonal Bed Sets
    • Duvet Cover Sets
    • Eco-Friendly Bed Sets
    • Luxury Bed Sets
    • Sheet Sets
    • Duvet Cover Sets

    Blanket

    • Wool Blankets
    • Fleece Blankets
    • Electric Blankets
    • Sherpa Blankets
    • Weighted Blankets
    • Throw Blankets
    • Knit Blankets
    • Cotton Blankets

    Curtains

    • Sheer curtains
    • Thermal curtains
    • Grommet curtains
    • Pleated curtains
    • Blackout curtains
    • Rod pocket curtains
    • Valances
    • Swags

    Garden & Outdoor

    • Outdoor Seating
    • Outdoor Tables
    • Outdoor Storage
    • Planters & Pots
    • Outdoor Heating
    • Outdoor Lighting
    • Garden Structures
    • Outdoor Dining
    Home Decorations
  • Pet Food

    Cat Food

    • Dry Cat Food
    • Wet Cat Food
    • Grain-Free Cat Food
    • Kitten Food
    • Senior Cat Food
    • Prescription Diet Cat Food
    • Organic Cat Food
    • High-Protein Cat Food

    Dog Food

    • Dry Dog Food
    • Wet Dog Food
    • Grain-Free Dog Food
    • Puppy Food
    • Senior Dog Food
    • Prescription Diet Dog Food
    • Organic Dog Food
    • High-Protein Dog Food

    Birds Food

    • Seed Mixes
    • Pellets
    • Fresh Fruits and Vegetables
    • Nectar and Grit
    • Soft Food and Mash
    • Treats
    • Foraging Mixes
    • Supplements

    Fish Food

    • Flake Food
    • Pellets
    • Freeze-Dried Food
    • Live Food
    • Frozen Food
    • Specialty Diets
    • Vegetarian Food
    • Treats
    Pet Food
  • New Year Sale

    December Sale upto 50% OFF

    New Year Sale
  • Gifts & Crafts

    Craft Supplies

    • Paper Crafting
    • Painting & Drawing
    • Sewing & Textiles
    • Beading & Jewelry Making
    • Knitting & Crochet
    • Adhesives
    • Modeling & Sculpting
    • Craft Tools

    DIY Kits

    • Craft Kits
    • Model Building Kits
    • Art & Painting Kits
    • Candle Making Kits
    • Soap Making Kits
    • Woodworking Kits
    • Textile Craft Kits

    Greeting Cards & Wrapping

    Handmade Gifts

    • Handmade Jewelry
    • Wine & Cheese Baskets
    • Handmade Painting
    • Personalized Gifts
    • Handmade Textiles
    • Fashion Accessories
    • Plants & Planters
    Gifts & Crafts
  • Sports, Fitness & Outdoors

    Leisure Sports

    • Golf
    • Bowling
    • Billiards/Pool
    • Tennis
    • Badminton
    • Table Tennis
    • Pickleball
    • Bocce Ball

    Outdoor Recreation

    • Camping
    • Hiking
    • Fishing
    • Kayaking
    • Rock Climbing
    • Mountain Biking
    • Trail Running
    • Stand-Up Paddleboarding

    Team Sports

    • Bike Pumps
    • Soccer
    • Softball
    • Mountain Bikes
    • Cycling Jerseys
    • Basketball
    • Handball
    • Baseball

    Cycling

    • Road Bikes
    • Hybrid Bikes
    • Cycling Shorts
    • Bike Saddles
    • Bike Tires
    • Cycling Helmets
    • Bike Chains
    • Cycling Gloves
    Sports, Fitness & Outdoors
  • Automotive

    Car Electronics

    • Audio Systems

    Tires & Wheels

    • Spare Tires
    • All-Season Tires
    • Tire Pressure Monitoring Systems (TPMS)
    • Steel Wheels
    • Winter Tires
    • Chrome Wheels
    • Tire Repair Kits
    • Summer Tires

    Car Parts & Accessories

    • Interior Accessories
    • Engine Components
    • Transmission and Drivetrain
    • Exhaust System
    • Braking System
    • Suspension and Steering
    • Cooling System
    • Body Parts

    Car Electronics

    • Sound Deadening Materials
    • Safety and Security
    • Car Lighting
    • Miscellaneous Car Electronics
    • Car Cameras and Sensors
    • Navigation Systems
    • Entertainment Systems
    • Remote Start Systems
    Automotive
  • Grocery

    Dairy Products

    • Milk
    • Cheese
    • Yogurt
    • Butter and Margarine
    • Cream and Half-and-Half

    Nut Butters and Spreads

    • Peanut Butter
    • Almond Butter
    • Cashew Butter
    • Seed Butters
    • Nutella and Chocolate Spreads

    Snacks

    • Chips and Crisps
    • Pretzels
    • Nuts and Seeds
    • Popcorn
    • Granola Bars
    • More Snacks

    Meat and Poultry

    • Fresh Meat (Beef, Pork, Lamb)
    • Processed Meats (Sausages, Bacon)
    • Deli Meats
    • Frozen Meat
    Grocery
  • Crockery

    Dinner Set

    • Porcelain Dinner Set
    • Bone China Dinner Set
    • Buffet set
    • Melamine Dinner Set
    • Marble Dinner Set
    • Stoneware Dinner Set
    • Stoneware Dinner Set
    • Ceramic Dinner Set

    Serving Set

    • Serving Trays
    • Serving Trays
    • Serving Platters
    • Serving Utensils
    • Serving Utensils
    • Divided platters
    • Serving Utensils
    • Oval platters

    Serving Bowl

    • Large serving bowls
    • Salad serving bowls
    • Salad serving bowls
    • Punch bowls
    • Dip bowls
    • Serving sets with utensils

    Bowls

    • Soup bowls
    • Cereal bowls
    • Salad bowls
    • Pasta bowls
    • Rice bowls
    Crockery
  • Office Products & Stationary

    Writing Instruments

    • Ballpoint Pens
    • Fountain Pens
    • Gel Pens
    • Rollerball Pens
    • Mechanical Pencils
    • Wooden Pencils
    • Markers
    • Highlighters

    Stationery

    • Notebooks and Journals
    • Pens and Pencils
    • Paper and Envelopes
    • Planners and Calendars
    • Folders and Binders
    • Markers and Highlighters
    • Sticky Notes and Memo Pads
    • Staplers and Staples

    Presentation Supplies

    • Presentation Binders
    • Presentation Folders
    • Laser Pointers
    • Presentation Remotes
    • Flip Charts
    • Projector Screens
    • Dry Erase Boards
    • Easel Pads

    Technical Drawing Supplies

    • Drawing Boards
    • Drafting Tools
    • Drawing Pencils
    • Technical Pens
    • Compass and Divider Sets
    • Rulers and Straightedges
    • Templates
    • Drafting Paper
    Office Products & Stationary
  • Home & Kitchen

    Food Warmer

    • Buffet Warmers
    • Warming Drawers
    • Heat Lamps
    • Food Warmer Trays
    • Chafing Dishes

    Cooking Appliances

    • Ovens
    • Microwaves
    • Ranges and Cooktops
    • Toasters and Toaster Ovens
    • Air Fryers
    • Slow Cookers and Crockpots

    Kitchen Storage and Organization

    • Pan and Pot Storage
    • Pantry Storage
    • Silverware and Cutlery Storage
    • Cabinet Storage
    • Kitchen Cart and Trolley
    • Countertop Storage
    • Organizational Accessories
    • Refrigerator and Freezer Storage

    Refrigeration Appliances

    • Refrigerators
    • Freezers
    • Wine Coolers
    • Ice Makers
    • Beverage Coolers
    Home & Kitchen
  • Electronics

    Garden Lighting

    • Solar Garden Lights
    • Spotlights
    • Path Lights
    • Outdoor Lanterns
    • Decorative Garden Lights

    Lighting Accents

    Audio Equipment

    • Headphones
    • Earbuds
    • Portable Speakers
    • Bluetooth Speakers
    • Home Audio Systems

    Televisions and Home Entertainment

    • Smart TVs
    • 4K UHD TVs
    • Home Theater Systems
    • Streaming Devices
    • Soundbars
    Electronics
  • Toys & Games

    Toys

    • Action Figures
    • Dolls
    • Building Sets
    • Educational Toys
    • Games and Puzzles
    • Arts and Crafts
    • Musical Toys
    • Vehicles

    Games

    • Board Games
    • Puzzle and Brain Teasers
    • Card Games
    • Puzzles
    • Dice Games
    • Video Games
    • Educational Games
    • Party Games

    Outdoor Play

    • Outdoor Games
    • Outdoor Toys
    Toys & Games
Filter
To
  • Beauty & Personal Care
    • Makeup
      • Makeup Brushes
      • Foundation
      • Hair Style Spray
      • Concealer
      • Makeup Sponges
      • Face and Body Gems
      • Face Powder
      • Blush
      • Highlighter
      • Airbrush Makeup
      • Contour
      • Makeup Brush Cleaners
      • Primer
      • Makeup Tools Storage
      • Makeup Tools
      • Makeup Palettes & Kits
      • Lipstick
      • Lip Gloss
      • Lip Liner
      • BB and CC Creams
      • Setting Spray
      • Makeup Remover
    • Skin Care
      • Moisturizer
      • Scrub
      • Facial Peels
      • Toner
      • Cleanser
      • Moisturizers and creams
      • Cream
      • Serums and treatments
      • Sunscreen
      • Face Mask
      • After-Sun Care
      • Facial & Bleach Creams
      • Patches
      • Facewash
      • Skin care Kit
    • Sustainable and Natural Products
      • Organic skincare
      • Natural hair care
      • Eco-friendly packaging
      • Cruelty-free products
    • Fragrances
      • Perfumes
      • Colognes
      • Body sprays
      • Perfume Rollerballs
    • hair dryer
    • Hair Care
      • Hair Brushes and Combs
      • Shampoo
      • Hair Straighteners
      • Conditioner
      • Hair Treatments
      • Electric Hair Brush
      • Hair Tools
      • Hair Accessories
      • Hair Color
      • Hair Extensions
      • Hair Regrowth Treatments
      • Hair Dryers
    • Spa and Relaxation Accessories
      • Aromatherapy diffusers
      • Bathrobes and slippers
      • Massage oils and lotions
      • Home spa kits
    • Eyes Care & Makeup
      • Eye Glitter
      • Eyeshadow
      • Eyeliner
      • Mascara
      • Eyebrow Tools
      • Eyebrow Products
      • Eyelashes & Accessories
      • Eyes cream & Treatment
      • Eye Makeup Remover
      • Contact Lens-Friendly Makeup
      • Eyes serums
      • Under-eye masks
    • Nail Care
      • Nail polish
      • Nail Accessories
      • Manicure sets
      • Nail Extension
      • Nail treatments
      • Nail art supplies
    • Oral Care
      • Toothpastes
      • Mouthwashes
      • Toothbrushes
      • Dental floss
      • Mouth Freshener
      • Electric Toothbrushes
    • Bath and Body
      • Body washes
      • Body lotions
      • Body scrubs
      • Body Soap
      • Hand Wash
    • Body Hair Removal
      • Waxing kits
      • Hair removal creams
      • Electric shavers and epilators
      • Tweezers & Scissors
    • Hand and Foot Care
      • Hand creams
      • Feet creams
      • Hand & feet moisturiser
      • Callus removers
      • Hand sanitizers
  • Women's Fashion
    • Bottoms
      • Jeans
      • Skirts
      • Shorts
      • Leggings
    • Tops
      • Tops
      • Blouses
      • Dresses
      • Women's T-shirts
      • Tank tops
      • Crop tops
      • Intimates
    • Women`s Accessories
      • Women`s Hand Bags
      • Scarves
      • Women`s Back Bags
      • Hats
      • Belts
      • Gloves
      • Sunglasses
    • Dresses
      • Casual dresses
      • Evening gowns
      • Cocktail dresses
      • Cardigans
      • Maxi dresses
    • Activewear
      • Sports bras
      • Leggings
      • Athletic tops
      • Hoodies
    • Swimwear
      • Bikinis
      • One-piece swimsuits
      • Cover-ups
      • Tankinis
    • Women`s Outerwear
      • Coats
      • Jackets
      • Blazers
    • Women`s Socks
      • Ankle Socks
      • Crew Socks
      • Knee-High Socks
      • No-Show Socks
      • Over-the-Knee Socks
      • Tights & Hosiery
    • Footwear
      • Oxford Shoes
      • Heels
      • Flats
      • Boots
      • Sandals
      • Sneakers
      • Slippers
      • Athletic Shoes
      • Outdoor Shoes
      • wedges shoes
      • Work & Safety Shoes
    • Sleepwear
      • Pajama sets
      • Silk Nightgown
      • Nightgowns
      • Robes
      • Sleep shirt
    • Intimates
      • Bras
      • Panties
      • Lingerie
      • Shapewear
    • Jewelry
      • Necklaces
      • Earrings
      • Bracelets
      • Rings
      • Women's Watches
  • Health & Household
    • Vitamins & Supplements
      • Testosterone Booster
      • Multivitamins
      • Herbal Supplements
      • Probiotics
      • Omega-3 & Fish Oil
      • Calcium & Vitamin D
      • Immune Support
      • Energy & Endurance
      • Protein Supplements
      • Weight Management
      • Sleep & Relaxation
    • First Aid Supplies
      • First Aid Kit
      • Bandages & Dressings
      • Antiseptics & Ointments
      • Pain Relief Medication
      • Gauze & Pads
      • Medical Tape
      • Splints & Supports
      • Thermometers
      • Burn Care Products
      • CPR Masks & Shields
    • Masks
  • Pets
    • Pet Toys
      • Chew Toys
      • Interactive Toys
      • Fetch Toys
      • Catnip Toys
      • Puzzle Toys
    • Pet Carriers and Travel
      • Flea and Tick Prevention
      • Pet Carriers
      • Travel Crates
      • Car Seat Covers
      • Travel Water Bowls
      • Pet Travel Bags
    • Pet Housing
      • Dog Houses
      • Cat Trees and Scratching Posts
      • Hamster Cages
      • Bird Cages
    • Pet Feeding Accessories
      • Food and Water Bowls
      • Automatic Feeders
      • Rabbit Hutches
      • Water Dispensers
      • Elevated Feeders
      • Food Storage Containers
    • Pet Cleaning Supplies
      • Litter Boxes
      • Litter Scoopers
      • Waste Bags
      • Pet Wipes
      • Pet Stain and Odor Removers
    • Pet Accessories
      • ID Tags
      • Leashes and Harnesses
      • Pet Bowls
      • Car Seat Belts
      • Pet Tags and Charms
    • Pet Doors and Gates
      • Pet Doors
      • Adjustable Gates
      • Baby Gates
      • Indoor Pet Gates
      • Safety Gates
    • Pet Bedding
      • Pet Beds
      • Blankets
      • Crate Pads
      • Orthopedic Beds
      • Heated Beds
    • Pet Health Care
      • Worming Treatments
      • Vitamins and Supplements
      • First Aid Kits
      • Prescription Medications
    • Pet Training Accesories
      • Training Treats
      • Training Pads
      • Clickers
      • Training Collars
      • Training Books and Guides
    • Pet Apparel
      • Dog Coats and Jackets
      • Cat Collars
      • Pet Boots
      • Pet Sweaters
      • Raincoats
    • Pet Vitamins and Supplements
      • Joint Health Supplements
      • Digestive Health Supplements
      • Skin and Coat Supplements
      • Immune Support Supplements
      • Omega-3 Fatty Acids
    • Pet Grooming
      • Shampoos and Conditioners
      • Brushes and Combs
      • Nail Clippers
      • Ear Cleaners
      • Grooming Wipes
    • Pet Training and Behavior
      • Behavior Training Aids
      • Bark Collars
      • Anxiety Wraps
      • Crate Training Tools
      • Training Videos
  • Men's Fashion
    • Men's Tops
      • T-shirts
      • Polo shirts
      • Dress shirts
      • Henley shirts
    • Men's Bottoms
      • Jeans
      • Chinos
      • Shorts
      • Dress pants
    • Men's Bags
      • Backpacks
      • Messenger bags
      • Duffel Bags
      • Briefcases
    • Men's Outerwear
      • Men's Jackets
      • Coats
      • Blazers
      • Vests
    • Men's Eyewear
      • Men's Sunglasses
      • Reading glasses
      • Eyeglass Frames
      • Sports Glasses
    • Mens Jewellery
      • Men's Watches
      • Bracelets
      • Pendant
      • Cufflinks
    • Men's Activewear
      • Sports jerseys
      • Athletic Shorts
      • Workout tops
      • Track pants
    • Men's Casual Wear
      • Hoodies
      • Sweatshirts
      • Cargo pants
      • Casual shorts
    • Men's Grooming
      • Shaving
      • Beard Care
      • Electric Shavers
    • Men's Underwear
      • Boxers
      • Briefs
      • Boxer briefs
      • Undershirts
    • Men's Accessories
      • Belts
      • Ties
      • Scarves
      • Hats
    • Men's Suits
      • Business Suits
      • Tuxedos
      • Blazers
      • Suit vests
    • Men's Socks
      • Ankle socks
      • Crew socks
      • Dress Socks
      • Athletic Socks
    • Men's Footwear
      • Flats
      • Boots
      • Sandals
      • Sneakers
      • Athletic Shoes
      • Slippers
      • Outdoor Shoes
      • Loafers & Moccasins
      • Specialty Shoes
      • Men's Work & Safety Shoes
    • Men's Sleepwear
      • Pajama sets
      • Sleep shorts
      • Robes
      • Sleep shirts
    • Men's Swimwear
      • Swim trunks
      • Board Shorts
      • Swim Briefs
      • Rash Guards
  • Tools & Home Improvement
    • Hardware Tools
      • Screws and Nails
      • Bolts and Nuts
      • Hinges
      • Hooks and Brackets
      • Anchors
    • Paint and Supplies
      • Paint Brushes
      • Rollers
      • Paint Sprayers
      • Paint Trays
      • Painter's Tape
    • Building Supplies
      • Lumber
      • Drywall
      • Concrete and Cement
      • Insulation
      • Roofing Materials
    • Outdoor Power Equipment
      • Lawn Mowers
      • Leaf Blowers
      • Hedge Trimmers
      • Chainsaws
      • Pressure Washers
    • Plumbing
      • Pipe Wrenches
      • Plungers
      • Pipe Cutters
      • Faucet Repair Kits
      • Drain Snakes
    • Hand Tools
      • Hammers
      • Knife
      • Wrenches
      • Scraper
      • Pliers
      • Tape Measures
      • Multi Hands Tools
    • Home Security
      • Security Cameras
      • Motion Sensors
      • Door and Window Alarms
      • Smart Locks
      • Safe Boxes
    • Ladders and Step Stools
      • Extension Ladders
      • Step Ladders
      • Folding Stools
      • Multi-Position Ladders
      • Telescoping Ladders
    • Power Tools
      • Drills
      • Saws
      • Sanders
      • Grinders
      • Impact Drivers
    • Work Safety Gear
      • Safety Glasses
      • Work Gloves
      • Ear Protection
      • Hard Hats
      • Safety Vests
    • Storage and Organization
      • Tool Chests
      • Shelving Units
      • Storage Bins
      • Workbenches
      • Pegboards
    • Fasteners
      • Fasteners Nails
      • Screws
      • Staples
      • Rivets
      • Washers
  • Kid & Baby
    • Clothing
      • Baby Onesies
      • Boys 2pcs
      • Baby and Toddler Pants
      • Baby Dresses
      • Baby and Toddler Socks
      • Hats and Headwear
      • Baby Shoes
    • Sleepwear
      • Eyes Mask
      • Toddler Shirts and Tops
      • Pajama Sets
      • Nightgowns
      • Sleep Shirts
      • Sleep Rompers
      • Sleep Sacks
      • Loungewear
      • Robes
      • Sleep Pants
      • Sleepwear for Kids
      • Sleepwear for Adults
    • Outdoor Games & Entertainment
    • Kids' Bed Sets
      • Bedding Sets
      • Themed Bed Sets
      • Convertible Bed Sets
      • Comforter Sets
      • Duvet Covers
      • Sheet Sets
      • Pillow Sets
      • Blankets and Throws
      • Bumper Sets
      • Sleeping Bags
    • Outerwear
      • Coats
      • Jackets
      • Raincoats
      • Snowsuits
      • Vests
      • Outerwear Sets
      • Puffer Jackets
      • Cardigans
      • Hoodies
    • Footwear
      • Baby Booties
      • Infant Shoes
      • Toddler Sneakers
      • Sandals
      • Boots
      • Slippers
      • Dress Shoes
      • Running Shoes
      • Crocs and Slip-Ons
    • Accessories
      • Watches
      • Hats
      • Sun Protection
      • Bibs
      • Mittens and Gloves
      • Scarves
      • Socks
      • Headbands
      • Pacifiers and Teething Toys
      • Diaper Bags
      • Baby Carriers
    • Baby Food
      • Infant Cereal
      • Pureed Fruits
      • Pureed Vegetables
      • Baby Snacks
      • Stage 1 Baby Foods
      • Stage 2 Baby Foods
      • Stage 3 Baby Foods
      • Baby Food Pouches
      • Baby Formula
      • Infant Cereal
      • Organic Baby Foods
    • Kid Swimwear
      • Baby Swim Diapers
      • Infant Swim Suits
      • Toddler Swimwear
      • Swim Rash Guards
      • Baby Swim Vests
      • Sun Protection Swimwear
      • Baby and Toddler Swim Caps
      • Swim Goggles
      • Cover-Ups
      • Swim Shoes
    • Bathing
      • Baby Bathtubs
      • Bath Seats
      • Bath Toys
      • Baby Shampoos
      • Baby Body Wash
      • Bath Towels
      • Bath Rinsers
      • Bath Mats
      • Bath Thermometers
    • Diapering
      • Diapers
      • Wipes
      • Diaper Rash Creams
      • Changing Pads
      • Diaper Bags
      • Diaper Pails
      • Diaper Liners
      • Diaper Rash Sprays
      • Diaper Covers
      • Diaper Accessories
    • Kids' Furniture
      • Kids' Beds
      • Dressers
      • Desks
      • Chairs
      • Bookcases
      • Nightstands
      • Storage Units
      • Changing Tables
      • Play Tables
      • Wardrobes
    • Kids' Carpets
      • Play Rugs
      • Character Rugs
      • Educational Rugs
      • Interactive Rugs
      • Themed Carpets
      • Plush Carpets
      • Area Rugs
      • Tapis
      • Personalized Rugs
      • Anti-Slip Rugs
    • Baby Gear
      • Car Seats
      • Strollers
      • High Chairs
      • Playards
      • Cribs
      • Baby Monitors
      • Bouncers and Rockers
      • Diaper Bags
      • Bathing Gear
    • Babies Personal Care
      • Baby Lotion
      • Safety Scissors
      • Diaper Rash Cream
      • Nasal Aspirators
      • Baby Powder
      • Saline Drops
      • Baby Hair Brush
      • Ear Cleaners
      • Baby Comb
      • Baby First Aid Kits
      • Detangling Spray
      • Thermometers
      • Baby Sunscreen
      • UV-Protective Clothing
      • Humidifiers
      • Baby Face Cream
      • Baby Nail Clippers
      • Baby Massage Oil
      • Baby Nail Files
      • Baby Oil
    • Nursery Furniture
      • Cribs
      • Changing Tables
      • Rocking Chairs and Gliders
      • Dresser Changers
      • Bassinet
      • Storage Solutions
      • Nursery Chairs
      • Crib Mattresses
      • Changing Pads
      • Nursery Shelves
    • Feeding
      • Bottles
      • Bottle Warmers
      • Breast Pumps
      • High Chairs
      • Sippy Cups
      • Baby Food Makers
      • Feeding Bibs
      • Baby Utensils
      • Feeding Bottles Accessories
      • Food Storage Containers
  • Pet Food
    • Cat Food
      • Dry Cat Food
      • Wet Cat Food
      • Grain-Free Cat Food
      • Kitten Food
      • Senior Cat Food
      • Prescription Diet Cat Food
      • Organic Cat Food
      • High-Protein Cat Food
      • Limited Ingredient Cat Food
      • Weight Management Cat Food
    • Dog Food
      • Dry Dog Food
      • Wet Dog Food
      • Grain-Free Dog Food
      • Puppy Food
      • Senior Dog Food
      • Prescription Diet Dog Food
      • Organic Dog Food
      • High-Protein Dog Food
      • Limited Ingredient Dog Food
      • Weight Management Dog Food
    • Birds Food
      • Seed Mixes
      • Pellets
      • Fresh Fruits and Vegetables
      • Nectar and Grit
      • Soft Food and Mash
      • Treats
      • Foraging Mixes
      • Supplements
      • Specialty Foods
      • Hand-Feeding Formulas
    • Fish Food
      • Flake Food
      • Pellets
      • Freeze-Dried Food
      • Live Food
      • Frozen Food
      • Specialty Diets
      • Vegetarian Food
      • Treats
      • Breeding Food
      • Supplemental Food
    • Small Mammals Food
      • Pellets
      • Seed Mixes
      • Hay Food
      • Foraging Mixe
      • Supplemental Foods
      • Hand-Feeding Formulas
      • Bedding and Chews
    • Reptiles Food
      • Live Food
      • Frozen Food
      • Pellets
      • Veggie Mixes
      • Insects
      • Herbivore Diets
      • Fresh Fruits and Vegetables
      • Omnivore Diets
      • Calcium Supplements
      • Vitamin Supplements
      • Specialty Foods
  • Digital Goods
  • Home Decorations
    • Bed Sets
      • Comforter Sets
      • Luxury Bed Sets
      • Seasonal Bed Sets
      • Duvet Cover Sets
      • Eco-Friendly Bed Sets
      • Luxury Bed Sets
      • Sheet Sets
      • Duvet Cover Sets
      • Eco-Friendly Bed Sets
      • Customizable Bed Sets
      • Sheet Sets
      • Bedding Collections
      • Bed-in-a-Bag Sets
      • Quilt & Coverlet Sets
      • Quilt & Coverlet Sets
      • Mattress & Pillow Protector Sets
      • Pillowcase Sets
      • Blanket Sets
      • Blanket Sets
      • Teen Bed Sets
    • Blanket
      • Wool Blankets
      • Fleece Blankets
      • Electric Blankets
      • Sherpa Blankets
      • Weighted Blankets
      • Throw Blankets
      • Knit Blankets
      • Cotton Blankets
      • Heated Throw Blankets
      • Decorative Blankets
      • Baby Blankets
      • Baby Blankets
      • Quilted Blankets
      • Emergency Blankets
      • Emergency Blankets
    • Curtains
      • Sheer curtains
      • Thermal curtains
      • Grommet curtains
      • Pleated curtains
      • Blackout curtains
      • Rod pocket curtains
      • Valances
      • Swags
      • Cafe curtains
      • Tab top curtains
    • Garden & Outdoor
      • Outdoor Seating
      • Outdoor Tables
      • Outdoor Storage
      • Planters & Pots
      • Outdoor Heating
      • Outdoor Lighting
      • Garden Structures
      • Outdoor Dining
      • Water Features
      • Garden Tools & Equipment
      • Outdoor Privacy Solutions
    • Blinds
      • Vertical blinds
      • Venetian blinds
      • Mini blinds
      • Horizontal blinds
      • Faux wood blinds
      • Roman shades
      • Roller shades
      • Aluminum blinds
      • Bamboo blinds
      • Cellular shades
    • Rugs
      • Area Rugs
      • Outdoor Rugs
      • Vintage & Antique Rugs
      • Machine-Made Rugs
      • Runner Rugs
      • Machine-Made Rugs
      • Braided Rugs
      • Shag Rugs
      • Round Rugs
      • Kids' Rugs
      • Kitchen Rugs
      • Bathroom Rugs
      • Rug Pads
      • Handmade Rugs
      • Natural Fiber Rugs
    • Bathrooms Accessories
      • Towel
      • Shower & Bath Accessories
      • Towel Holders
      • Toilet Accessories
      • Bathroom Carpets
      • Storage & Organization
      • Mirrors
      • Soap & Dispensers
      • Trash Cans
      • Bathroom Sets
      • Toothbrush Holders
      • Bath Safety Accessories
    • Blanket,Rugs & Carpets
    • Furniture
      • Bedroom Furniture
      • Living Room Furniture
      • Dining Room Furniture
      • Storage Furniture
      • Entryway Furniture
      • Accent Furniture
      • Specialty Furniture
      • Media Furniture
      • Outdoor Furniture Covers
    • Carpets
      • Area Carpets
      • Natural Fiber Carpets
      • Vintage & Antique Carpets
      • Runner Carpets
      • Machine-Made Carpets
      • Outdoor Carpets
      • Eco-Friendly Carpets
      • Shag Carpets
      • Braided Carpets
      • Wall-to-Wall Carpets
      • Carpet Tiles
      • Kitchen Carpets
      • Handmade Carpets
    • Window Films
      • Privacy films
      • Heat-control films
      • Static cling films
      • Etched glass films
      • Colored films
      • Decorative films
      • Frosted films
      • Stained glass films
      • UV-blocking films
    • Home Fragrance
      • Reed Diffusers
      • Room Sprays
      • Electric Diffusers
      • Smart Home Fragrance Devices
      • Air Purifiers with Scent
      • Scented Candles
      • Essential Oils
      • Wax Melts
      • Potpourri
      • Car Air Fresheners
      • Gel Air Fresheners
      • Scented Sachets
      • Fragrance Oils
      • Smart Home Fragrance Devices
      • Aromatherapy Devices
    • Decorative Accents
      • Clocks
      • Wall Art
      • Vases & Bowls
      • Picture Frames
      • Throw Pillows & Cushions
      • Decorative Trays
      • Artificial Plants & Flowers
      • Incense
      • Books & Bookends
      • Ornaments & Decorative Objects
      • Candles & Holders
      • Mirrors
      • Decorative Storage
      • Sculptures & Figurines
  • New Year Sale
    • December Sale upto 50% OFF
  • Gifts & Crafts
    • Craft Supplies
      • Paper Crafting
      • Painting & Drawing
      • Sewing & Textiles
      • Beading & Jewelry Making
      • Knitting & Crochet
      • Adhesives
      • Modeling & Sculpting
      • Craft Tools
      • Decorative Elements
      • Kids' Crafts
    • DIY Kits
      • Craft Kits
      • Model Building Kits
      • Art & Painting Kits
      • Candle Making Kits
      • Soap Making Kits
      • Woodworking Kits
      • Textile Craft Kits
    • Greeting Cards & Wrapping
    • Handmade Gifts
      • Handmade Jewelry
      • Handmade Painting
      • Wine & Cheese Baskets
      • Personalized Gifts
      • Handmade Textiles
      • Fashion Accessories
      • Plants & Planters
    • Stickers
      • Kids' Stickers
      • Functional Stickers
      • Art & Illustration Stickers
    • Key Chains
      • Personalized Key Chains
      • Novelty Key Chains
      • Luxury Key Chains
      • Functional Key Chains
      • Sports Key Chains
      • Souvenir Key Chains
      • Eco-Friendly Key Chains
      • Souvenir Key Chains
      • Fashion Key Chains
      • Collectible Key Chains
    • Stickers
      • Decorative Stickers
      • Planner Stickers
      • Custom Stickers
      • Holiday & Seasonal Stickers
      • Scrapbooking Stickers
      • Vinyl Stickers
      • 3D & Puffy Stickers
    • Gift Baskets
      • Gourmet Food Basket
      • Gourmet Food Basket
      • Fruit Baskets
      • Gift Bag
      • Spa & Relaxation Baskets
      • Chocolate & Sweets Baskets
      • Coffee & Tea Baskets
      • Breakfast Baskets
      • Baby Gift Baskets
      • Holiday Baskets
      • Healthy Snack Baskets
    • Wish Card
      • Love & Friendship Cards
      • Birthday Cards
      • Holiday Cards
      • New Baby Cards
      • Thank You Cards
      • Get Well Soon Cards
      • Congratulations Cards
      • Wedding & Anniversary Cards
      • Sympathy & Condolence Cards
      • Inspirational & Encouragement Cards
  • Sports, Fitness & Outdoors
    • Leisure Sports
      • Golf
      • Bowling
      • Billiards/Pool
      • Tennis
      • Badminton
      • Table Tennis
      • Pickleball
      • Bocce Ball
      • Frisbee Golf (Disc Golf)
      • Croquet
    • Outdoor Recreation
      • Camping
      • Hiking
      • Fishing
      • Kayaking
      • Rock Climbing
      • Mountain Biking
      • Trail Running
      • Stand-Up Paddleboarding
      • Surfing
    • Team Sports
      • Bike Pumps
      • Soccer
      • Softball
      • Mountain Bikes
      • Cycling Jerseys
      • Basketball
      • Handball
      • Baseball
      • Football (American)
      • Water Polo
      • Electric Bikes (E-Bikes)
      • Folding Bikes
      • Volleyball
      • Ultimate Frisbee
      • Netball
      • Rugby
      • Dodgeball
      • Hockey (Ice Hockey)
      • Kickball
      • Field Hockey
      • Futsal
      • Gaelic Football
      • Cricket
      • Beach Volleyball
      • Lacrosse
    • Cycling
      • Road Bikes
      • Hybrid Bikes
      • Cycling Shorts
      • Bike Saddles
      • Bike Tires
      • Cycling Helmets
      • Bike Chains
      • Cycling Gloves
      • Cycling Water Bottles
      • Cycling Shoes
      • Cycling Computers
      • Bike Repair Tools
      • Bike Lights
      • Bike Locks
      • Bike Racks and Carriers
    • Exercise and Fitness Equipment
      • Treadmills
      • Stationary Bikes
      • Elliptical Machines
      • Medicine Balls
      • Weight Benches
      • Rowing Machines
      • Pull-Up Bars
      • Dumbbells
      • Home Gyms
      • Dumbbells
      • Barbells
      • Exercise Balls
      • Kettlebells
      • Ab Rollers
      • Punching Bags
      • Resistance Bands
      • Step Platforms
      • Yoga Mats
      • Fitness Trackers
      • Foam Rollers
      • Jump Ropes
      • Skiing
    • Water Sports
      • Swimwear
      • Wetsuits
      • Rash Guards
      • Water Shoes
      • Life Jackets
      • Goggles
      • Swim Caps
      • Snorkeling Gear
      • Diving Suits
      • Waterproof Bags
    • Outdoor Clothing
      • Waterproof Jackets
      • Hiking Boots
      • Fleece Jackets
      • Thermal Base Layers
      • Convertible Pants
      • Windbreakers
      • Insulated Vests
      • Gaiters
      • Sun Hats
      • Gloves and Mittens
    • Sportswear
      • Running Shoes
      • Compression Arm Sleeves
      • Athletic Shorts
      • Compression Wear
      • Sports Bras
      • Performance T-Shirts
      • Training Pants
      • Hoodies and Sweatshirts
      • Sports Jackets
      • Yoga Pants
      • Athletic Socks
  • Grocery
    • Dairy Products
      • Milk
      • Cheese
      • Yogurt
      • Butter and Margarine
      • Cream and Half-and-Half
    • Nut Butters and Spreads
      • Peanut Butter
      • Almond Butter
      • Cashew Butter
      • Seed Butters
      • Nutella and Chocolate Spreads
    • Snacks
      • Chips and Crisps
      • Pretzels
      • Nuts and Seeds
      • Popcorn
      • Granola Bars
      • More Snacks
    • Meat and Poultry
      • Fresh Meat (Beef, Pork, Lamb)
      • Processed Meats (Sausages, Bacon)
      • Deli Meats
      • Frozen Meat
    • Pantry Staples
      • Canned Goods
      • Pasta and Rice
      • Baking Ingredients (Flour, Sugar)
      • Condiments and Sauces
      • Grains and Legumes
    • Frozen Vegetables and Fruits
      • Frozen Berries
      • Frozen Green Beans
      • Frozen Corn
      • Frozen Mixed Vegetables
      • Frozen Tropical Fruits
    • Bakery Products
      • Bread
      • Rolls and Buns
      • Pastries
      • Cakes and Cupcakes
      • Bagels and English Muffins
    • Frozen Foods
      • Frozen Vegetables
      • Frozen Fruits
      • Frozen Meals
      • Ice Cream and Sorbet
      • Frozen Pizza
    • International Foods
      • Asian Foods
      • Mexican Foods
      • Italian Foods
      • Middle Eastern Foods
      • European Foods
    • Cooking Ingredients
      • Oils and Vinegars
      • Spices and Herbs
      • Broths and Stocks
      • Baking Mixes
      • Sweeteners
    • Canned and Jarred Foods
      • Soups and Stews
      • Vegetables and Beans
      • Fruits and Juices
      • Pasta Sauces
      • Pickles and Relishes
    • Condiments and Sauces
      • Ketchup and Mustard
      • Mayonnaise
      • Salad Dressings
      • Hot Sauces
      • Marinades
    • Health Foods
      • Organic Foods
      • Gluten-Free Products
      • Vegan Products
      • Low-Sugar Options
    • Cereal and Grains
      • Hot Cereals (Oatmeal, Cream of Wheat)
      • Cold Cereals
      • Quinoa
      • Barley
      • Polenta
    • Seafood
      • Fresh Fish
      • Frozen Fish
      • Shellfish
      • Canned Seafood
      • Seafood Mixes
    • Cooking Sauces
      • Soy Sauce
      • Teriyaki Sauce
      • BBQ Sauce
      • Alfredo Sauce
      • Pasta Sauces
    • Non-Dairy Alternatives
      • Almond Milk
      • Soy Milk
      • Coconut Milk
      • Oat Milk
      • Non-Dairy Creamers
    • Breakfast Foods
      • Cereals
      • Oatmeal
      • Pancake Mix
      • Breakfast Bars
      • Jams and Spreads
    • Beverages
      • Soft Drinks
      • Juices
      • Coffee and Tea
      • Bottled Water
      • Sports and Energy Drinks
      • Superfoods
    • Specialty Beverages
      • Kombucha
      • Cold Brew Coffee
      • Herbal Teas
      • Specialty Lemonades
      • Functional Drinks
    • Frozen Desserts
      • Frozen Cakes
      • Frozen Pies
      • Sorbets
      • Frozen Yogurt
      • Ice Cream Novelties
  • Crockery
    • Dinner Set
      • Porcelain Dinner Set
      • Bone China Dinner Set
      • Buffet set
      • Melamine Dinner Set
      • Marble Dinner Set
      • Stoneware Dinner Set
      • Stoneware Dinner Set
      • Ceramic Dinner Set
      • Ceramic Dinner Set
      • Ceramic Dinner Set
      • Ceramic Dinner Set
      • Ceramic Dinner Set
      • Ceramic Dinner Set
      • Ceramic Dinner Set
    • Serving Set
      • Serving Trays
      • Serving Trays
      • Serving Platters
      • Serving Utensils
      • Serving Utensils
      • Serving Utensils
      • Divided platters
      • Oval platters
      • Round platters
      • Divided platters
      • Divided platters
      • Rectangular platters
      • Tiered serving trays
    • Serving Bowl
      • Large serving bowls
      • Salad serving bowls
      • Salad serving bowls
      • Punch bowls
      • Dip bowls
      • Serving sets with utensils
    • Bowls
      • Soup bowls
      • Cereal bowls
      • Salad bowls
      • Pasta bowls
      • Rice bowls
    • Tea Sets
      • Porcelain tea sets
      • Bone china tea sets
      • Ceramic tea sets
      • Bone china tea sets
      • Vintage tea sets
      • Modern tea sets
    • Sugar Bowls and Creamers
      • Porcelain sugar bowls
      • Ceramic creamers
      • Stainless steel sugar and cream sets
      • Vintage sugar bowls and creamers
      • Sugar bowls with lids
    • Side Plates
      • Bread and butter plates
      • Appetizer plates
      • Appetizer plates
      • Appetizer plates
      • Appetizer plates
      • Appetizer plates
      • Appetizer plates
      • Dessert plates
      • Salad plates
      • Salad plates
      • Accent plates
      • Dessert plates
    • Cups and Saucers
      • Tea cups and saucers
      • Coffee cups and saucers
      • Breakfast cups and saucers
      • Demitasse cups and saucers
      • Demitasse cups and saucers
      • Double-walled cups
      • Double-walled cups
    • Pitchers and Jugs
      • Water pitchers
      • Juice jugs
      • Ceramic pitchers
      • Milk jugs
      • Ceramic pitchers
      • Ceramic pitchers
      • Glass pitchers
    • Coffee Set
      • Coffee mugs
      • Coffee mugs
      • Coffee mugs
      • Coffee cups and saucers
      • Cappuccino cups
      • Espresso cups
      • Cappuccino cups
      • Coffee pots
      • Personalized Decanters
    • Salad Servers
      • Appetizer serving sets
      • Dessert serving sets
      • Cheese serving sets
      • Sushi serving sets
    • Carafes and Decanters
      • Wine Decanters
      • Compact Carafes
      • Water Carafes
      • Juice Carafes
      • Modern Decanters
      • Modern Decanters
      • Personalized Decanters
      • Elegant Decanters
      • Decanter Sets
      • Personalized Decanters
      • Oil and Vinegar Carafes
      • Lead-Free Decanters
      • Large Capacity Carafes
      • Vintage Decanters
    • Butter Dishes
      • Covered butter dishes
      • Salad serving sets
      • Glass butter dishes
      • Ceramic butter dishes
      • Butter dishes with knife
      • Decorative butter dishes
    • Sauce Dishes
      • Dipping bowls
      • Dipping bowls
      • Soy Sauce Dishes
      • Condiment Bowls
      • Small Serving Bowls
      • Salsa Bowls
    • Soup Tureens
      • Lidded Soup Tureens
      • Porcelain Soup Tureens
      • Ceramic Soup Tureens
      • Ceramic Soup Tureens
      • Soup Tureens With Ladles
      • Stoneware Soup Tureens
      • Stainless Steel Soup Tureens
    • Gravy Boats
      • Porcelain gravy boats
      • Ceramic gravy boats
      • Stainless steel gravy boats
      • Gravy boats with attached underplates
      • Gravy boats with stands
    • Gravy Boats and Sauces
      • Gravy boats with attached saucers
      • Porcelain sauce boats
      • Melamine gravy boats
      • Decorative sauce boats
  • Automotive
    • Car Electronics
      • Audio Systems
    • Tires & Wheels
      • Spare Tires
      • All-Season Tires
      • Tire Pressure Monitoring Systems (TPMS)
      • Steel Wheels
      • Winter Tires
      • Chrome Wheels
      • Tire Repair Kits
      • Summer Tires
      • Forged Wheels
      • Performance Tires
      • Off-Road Tires
      • Custom Wheels
      • Touring Tires
      • Wheel Covers and Hubcaps
      • Wheel Spacers and Adapters
      • Alloy Wheels
      • Alloy Wheels
      • Wheel Locks
      • Wheel Cleaning and Care Products
      • Run-Flat Tires
      • Trailer Tires
      • Trailer Tires
      • Tire Chains
      • Tire Inflators and Gauges
      • Tire Balancers
      • Truck and SUV Tires
      • Motorcycle Tires
      • Racing Tires
      • Wheel Alignment Tools
      • Commercial Vehicle Tires
      • Tire Storage Solutions
      • Tire and Wheel Accessories
    • Car Parts & Accessories
      • Interior Accessories
      • Engine Components
      • Transmission and Drivetrain
      • Exhaust System
      • Braking System
      • Suspension and Steering
      • Cooling System
      • Body Parts
      • Fuel System
      • Exterior Accessories
      • Air Intake and Filters
    • Car Electronics
      • Sound Deadening Materials
      • Safety and Security
      • Car Lighting
      • Miscellaneous Car Electronics
      • Car Cameras and Sensors
      • Navigation Systems
      • Entertainment Systems
      • Remote Start Systems
      • Car Chargers and Adapters
      • Radar Detectors and Laser Jammers
      • Vehicle Tracking and Monitoring
      • Bluetooth and Hands-Free Devices
      • OBD-II Scanners and Diagnostic Tools
      • Performance Tuners and Programmers
    • Car Care
      • Cleaning Supplies
      • Car Air Fresheners
      • Detailing Products
      • Waxes and Sealants
      • Polishes and Compounds
      • Tire and Wheel Care
      • Interior Care
      • Glass Care
      • Wash Accessories
      • Applicators and Brushes
      • Deodorizers
      • Pressure Washers and Accessories
      • Vacuum Cleaners
      • Car Covers and Sunshades
      • Paint Protection
      • Tool Kits and Accessories
    • Performance Parts
      • Air Intake Systems
      • Exhaust Systems
      • Fuel Systems
      • Ignition Systems
      • Cooling Systems
      • Suspension Systems
      • Braking Systems
      • Drivetrain Components
      • Electronics and Tuning
      • Aerodynamics
      • Gauges and Monitoring
      • Body and Chassis
      • Transmission Upgrades
  • Office Products & Stationary
    • Writing Instruments
      • Ballpoint Pens
      • Fountain Pens
      • Gel Pens
      • Rollerball Pens
      • Mechanical Pencils
      • Wooden Pencils
      • Markers
      • Highlighters
      • Brush Pens
      • Chalk Pens
    • Stationery
      • Notebooks and Journals
      • Pens and Pencils
      • Paper and Envelopes
      • Planners and Calendars
      • Folders and Binders
      • Markers and Highlighters
      • Sticky Notes and Memo Pads
      • Staplers and Staples
      • Paper Clips and Binder Clips
      • Scissors and Cutting Tools
    • Presentation Supplies
      • Presentation Binders
      • Presentation Folders
      • Laser Pointers
      • Presentation Remotes
      • Flip Charts
      • Projector Screens
      • Dry Erase Boards
      • Easel Pads
      • Brochure Holders
      • Display Boards
    • Technical Drawing Supplies
      • Drawing Boards
      • Drafting Tools
      • Drawing Pencils
      • Technical Pens
      • Compass and Divider Sets
      • Rulers and Straightedges
      • Templates
      • Drafting Paper
      • Scale Rulers
    • Correction Supplies
      • Correction Tape
      • Correction Fluid
      • Pencil Erasers
      • Ink Erasers
      • Correction Tape Dispensers
      • Correction Pens
      • White-Out Pens
      • Correction Tape Refills
      • Eraser Pencils
      • Eraser Shields
      • Electric Erasers
    • Boards & Easels
      • Whiteboards
      • Chalkboards
      • Cork Boards
      • Pinboards
      • Flip Charts
      • Drawing Boards
      • Artist Easels
      • Presentation Boards
      • Magnetic Boards
      • Notice Boards
    • Mailing Supplies
      • Mailing Boxes
      • Packing Tape
      • Shipping Labels
      • Bubble Wrap
      • Packing Peanuts
      • Mailing Tubes
      • Shipping Scales
      • Postal Forms and Supplies
      • Mail Organizers
    • Calendars & Planners
      • Wall Calendars
      • Desk Calendars
      • Daily Planners
      • Weekly Planners
      • Monthly Planners
      • Academic Planners
      • Personal Organizers
      • Pocket Planners
      • Digital Planners
    • Staplers & Punches
      • Desktop Staplers
      • Heavy-Duty Staplers
      • Electric Staplers
      • Handheld Staplers
      • Staple Guns
      • Mini Staplers
      • Staple Removers
      • Single-Hole Punches
      • Three-Hole Punches
      • Heavy-Duty Hole Punches
    • Labels & Labeling Systems
      • Label Makers
      • Address Labels
      • File Labels
      • Name Tags
      • Price Tags
      • Barcode Labels
      • Color-Coding Labels
      • Shipping Labels
      • Laser Labels
      • Waterproof Labels
    • Adhesives & Tapes
      • Glue Sticks
      • Liquid Glue
      • Super Glue
      • Double-Sided Tape
      • Masking Tape
      • Duct Tape
      • Scotch Tape
      • Mounting Tape
      • Glue Dots
    • Office Furniture
      • Desks
      • Office Chairs
      • File Cabinets
      • Bookcases
      • Conference Tables
      • Office Storage
      • Reception Furniture
      • Cubicles and Partitions
      • Tables
      • Lounge Furniture
    • Filing & Organization
      • Folders
      • Binders
      • File Cabinets
      • File Boxes
      • Dividers
      • Labeling Systems
      • Desk Organizers
      • Shelving Units
      • Document Protectors
      • Dry Erase Calendars
      • Magazine Holders
    • Paper Products
      • Notebooks
      • Journals
      • Printer Paper
      • Envelopes
      • Sticky Notes
      • Legal Pads
      • Sketch Pads
      • Construction Paper
      • Index Cards
      • Stationery Paper
    • Arts & Crafts Supplies
      • Paints
      • Brushes
      • Drawing Supplies
      • Paper
      • Adhesives
      • Markers
      • Beads and Jewelry Making
      • Scissors and Cutting Tools
      • Crafting Tools
      • Fabric and Sewing Supplies
    • Clipboards & Forms
      • Clipboards
      • Writing Pads
      • Form Holders
      • Checkbook Holders
      • Document Holders
      • Index Card Holders
      • Board Forms
      • Writing Tablet Covers
      • Form Folders
    • Storage Solutions
      • Shelving Units
      • Storage Bins and Containers
      • Cabinets
      • Closet Organizers
      • Drawer Organizers
      • Bins and Baskets
      • Under-Bed Storage
      • Storage Ottomans
      • Garage Storage Solutions
      • Office Storage
    • Office Electronics
      • Printers
      • Scanners
      • Fax Machines
      • Photocopiers
      • Shredders
      • Projectors
      • Telephones
      • Label Makers
      • Document Cameras
      • Conference Call Systems
  • Home & Kitchen
    • Food Warmer
      • Buffet Warmers
      • Warming Drawers
      • Heat Lamps
      • Food Warmer Trays
      • Chafing Dishes
    • Cooking Appliances
      • Ovens
      • Microwaves
      • Ranges and Cooktops
      • Toasters and Toaster Ovens
      • Air Fryers
      • Slow Cookers and Crockpots
    • Kitchen Storage and Organization
      • Pan and Pot Storage
      • Pantry Storage
      • Silverware and Cutlery Storage
      • Cabinet Storage
      • Kitchen Cart and Trolley
      • Countertop Storage
      • Organizational Accessories
      • Refrigerator and Freezer Storage
      • Drawer Organizers
      • Under-Sink Storage
      • Wall-Mounted Storage
      • Over-the-Door Storage
      • Food Storage Solutions
      • Baking Storage
    • Refrigeration Appliances
      • Refrigerators
      • Freezers
      • Wine Coolers
      • Ice Makers
      • Beverage Coolers
    • Dishwashing Appliances
      • Dishwashers
      • Dish Dryer Racks
      • Dishwasher Detergents
      • Dishwasher Accessories
      • Portable Dishwashers
    • Tableware
      • Dinnerware
      • Flatware
      • Glassware
      • Serveware
      • Table Linens
      • Chafing Dishes
      • Tea and Coffee Sets
      • Cutlery Sets
      • Serving Utensils
      • Condiment Holders
      • Baking and Roasting Dishes
      • Cheese Boards and Cutlery
      • Barware
      • Appetizer Plates
      • Decorative Tableware
    • Copper Cookware
      • Copper Pots and Pans
      • Copper Sauté Pans
      • Copper Roasting Pans
      • Copper Baking Sheets
    • Food Preparation Appliances
      • Blenders
      • Food Processors
      • Stand Mixers
      • Hand Mixers
      • Choppers and Slicers
    • Grill Pans and Cookware
    • Cleaning Supplies
      • Clothes surf & bleach
      • Kitchen Supplies
      • Cleaning Tools
      • Glass and Mirror Cleaners
      • Floor Care
      • Surface Cleaners
      • Cleaning Chemicals
      • Bathroom Supplies
      • Air Fresheners and Deodorizers
      • Cleaning Equipment
      • Hand and Dishwashing
      • Industrial and Commercial Cleaners
      • Trash and Waste Management
      • Laundry Supplies
      • Specialty Cleaners
      • Disinfectants
    • Cooking and Baking Thermometers
      • Meat Thermometers
      • Oven Thermometers
      • Candy Thermometers
      • Instant-Read Thermometers
      • Probe Thermometers
    • Roasting and Baking Dishes
      • Casserole Dishes
      • Baking Dishes
      • Lasagna Pans
      • Roasting Racks
      • Gratin Dishes
    • Countertop Appliances
      • Toaster Ovens
      • Electric Can Openers
      • Coffee Grinders
      • Handheld Blenders
      • Manual Juicers
    • Beverage Appliances
      • Coffee Makers
      • Espresso Machines
      • Kettles and Electric Teapots
      • Juicers
      • Drink Dispensers
    • Pressure Cookers and Slow Cookers
      • Electric Pressure Cookers
      • Stovetop Pressure Cookers
      • Slow Cookers
      • Multi-Cookers
      • Rice Cookers
    • Baking Tools & Cooking Utensils
      • Knife
      • Rolling Pins
      • Wooden Spoons
      • Forks
      • Cookie Cutters
      • Spatulas
      • Slotted Spoons
      • Measuring Cups and Spoons
      • Whisks
      • Pastry Bags and Tips
      • Tongs
      • Ladles
      • Meat & Poultry Tenderizers
      • Vegetable Cutter
      • Fruit Cutter
    • Baking Mats and Liners
      • Silicone Baking Mats
      • Parchment Paper
      • Non-Stick Baking Liners
      • Reusable Baking Liners
      • Oil Sprays
    • Heating Appliances
      • Electric Grills
      • Griddles
      • Sandwich Makers
      • Waffle Irons
      • Hot Plates
    • Cookware & Bakeware
      • Steamer Baskets
      • Cake Pans
      • Frying Pans and Skillets
      • Muffin Pans
      • Sauce Pans
      • Cookie Sheets
      • Stock Pots
      • Brownie Pans
      • Roasting Pans
      • Pie Dishes
      • Sauté Pans
      • Dutch Ovens
      • Woks
      • Crepe Pans
      • Griddle Pans
    • Cooling Appliances
      • Ice Cream Makers
      • Mini Fridges
      • Dehydrators
      • Popcorn Makers
    • Storage Appliances
      • Vacuum Sealers
      • Food Storage Containers
      • Spice Racks
      • Bread Boxes
      • Canned Food Dispensers
    • Non-Stick & Cookware Sets
      • Non-Stick Frying Pans
      • Cast Iron Skillets
      • Non-Stick Cookware Sets
      • Non-Stick Bakeware
      • Stainless Steel Cookware Sets
      • Non-Stick Sauce Pans
      • Cast Iron Cookware Sets
      • Cast Iron Dutch Ovens
      • Copper Cookware Sets
      • Multi-Ply Cookware Sets
      • Non-Stick Roasting Pans
      • Cast Iron Griddles
      • Cast Iron Grill Pans
      • Non-Stick Griddle Pans
      • Ribbed Grill Pans
      • Cast Iron Baking Pans
      • Indoor Grill Pans
      • Grill Presses
      • Panini Presses
      • Griddle Plates
    • Cleaning Appliances
      • Garbage Disposals
      • Countertop Dishwashers
      • Range Hoods
      • Air Purifiers
      • Steam Cleaners
    • Baking Appliances
      • Microwave Ovens
      • Convection Ovens
      • Pizza Ovens
      • Bread Makers
      • Electric Pressure Cookers
    • Specialty Appliances
      • Sous Vide Machines
      • Crepe Makers
      • Cheese Makers
    • Smart Appliances
      • Smart Ovens
      • Smart Refrigerators
      • Smart Coffee Makers
      • Smart Dishwashers
      • Smart Scales
  • Toys & Games
    • Toys
      • Action Figures
      • Dolls
      • Building Sets
      • Educational Toys
      • Games and Puzzles
      • Arts and Crafts
      • Musical Toys
      • Vehicles
      • Plush Toys
      • Pretend Play
      • Sports Toys
      • Electronic Toys
      • Building and Construction Toys
      • Party Toys and Favors
    • Games
      • Board Games
      • Puzzle and Brain Teasers
      • Card Games
      • Puzzles
      • Dice Games
      • Video Games
      • Educational Games
      • Party Games
      • Role-Playing Games (RPGs)
      • Strategy Games
      • Trivia Games
      • Social and Party Games
      • Sports Games
      • Role-Playing and Simulation Games
    • Outdoor Play
      • Outdoor Games
      • Outdoor Toys
  • Electronics
    • Garden Lighting
      • Solar Garden Lights
      • Spotlights
      • Path Lights
      • Outdoor Lanterns
      • Decorative Garden Lights
    • Lighting Accents
    • Audio Equipment
      • Headphones
      • Earbuds
      • Portable Speakers
      • Bluetooth Speakers
      • Home Audio Systems
    • Televisions and Home Entertainment
      • Smart TVs
      • 4K UHD TVs
      • Home Theater Systems
      • Streaming Devices
      • Soundbars
    • Cameras and Photography
      • Digital Cameras
      • DSLR Cameras
      • Mirrorless Cameras
      • Camera Lenses
      • Camera Accessories (Tripods, Memory Cards)
    • Outdoor String Lights
    • Electronics Accessories
    • Commercial Lighting
      • High Bay Lights
      • LED Panel Lights
      • T8/T5 Fluorescent Fixtures
      • Flood Lights
      • Industrial Pendant Lights
    • Wearable Technology
      • Smartwatches
      • Fitness Trackers
      • Smart Glasses
      • Wireless Headsets
      • Health Monitoring Devices
    • Bedroom Lighting
      • Bedside Lamps
      • Ceiling Fans with Lights
      • Dimmable Lights
      • Ambient Lighting
      • Reading Lights
    • Holiday Lighting
      • Christmas Lights
      • Halloween Lights
      • Hanukkah Lights
      • Easter Lights
      • Fourth of July Lights
    • Task Lighting
    • Bathroom Lighting
      • Vanity Lights
      • Recessed Lighting
      • Shower Lights
      • Mirror Lights
      • Ceiling Lights
    • Mobile Phones
    • Smart Home Devices
      • Smart Thermostats
      • Shirts Hair Remover Machine
      • Smart Lights
      • Smart Locks
      • Security Cameras
      • Voice Assistants (Alexa, Google Home)
    • Computers and Tablets
      • Laptops
      • Tablets
      • Desktops
      • All-in-One Computers
      • Computer Accessories (Keyboards, Mice)
    • Smart Lighting
      • Smart Bulbs
      • Smart Music Bluetooth Led Bulb
      • Smart Plugs
      • Smart Light Panels
      • Smart Light Strips
      • Smart Lamps
    • Outdoor Lighting
      • Security Lights
      • Floodlights
      • Landscape Lighting
      • Pathway Lights
      • Solar Garden Lights
    • Energy-Efficient Lighting
      • LED Bulbs
      • CFL Bulbs
      • Solar-Powered Lights
      • Motion Sensor Lights
      • Dimmer Switches
    • Smartphones and Accessories
      • Smartphones
      • Phone Cases
      • Screen Protectors
      • Chargers and Cables
      • Wireless Earbuds
    • Kitchen Lighting
      • Pendant Lights
      • Under-Cabinet Lighting
      • Ceiling Fixtures
      • Recessed Lighting
      • Track Lighting
    • Indoor Lighting
      • Pendant Lights
      • Chandeliers
      • Wall Sconces
      • Table Lamps
      • Ceiling Lights
    • Gaming
      • Gaming Consoles (PlayStation, Xbox, Nintendo Switch)
      • Gaming PCs
      • Gaming Accessories (Controllers, Keyboards, Mice)
      • VR Headsets
      • Gaming Chairs
    • Computer Components
      • Processors (CPUs)
      • Graphics Cards (GPUs)
      • Motherboards
      • RAM
      • Storage Devices (SSD, HDD)
    • Battery and Power
      • Portable Chargers
      • Batteries
      • Power Banks
      • Replacement Batteries
      • Battery Chargers
      • Uninterruptible Power Supplies (UPS)
    • Emergency Lighting
      • Flashlights
      • Emergency Lanterns
      • Rechargeable Flashlights
      • Emergency Exit Lights
      • Battery-Powered Lights
    • Decorative Lighting
    • Car Electronics
      • Car Stereos
      • GPS Navigation Systems
      • Dash Cams
      • Car Chargers
      • Bluetooth Car Kits
    • Educational Electronics
      • E-Readers
      • Learning Tablets for Kids
      • Digital Notebooks
      • Educational Robots
      • Language Translators
    • Outdoor Electronics
      • Portable Solar Chargers
      • Outdoor Speakers
      • Action Cameras
      • GPS Devices
      • Weather Radios
2CCLMMDLSFLDHMLSFAYAGYAPAFM-PINK-LIPSDREAYER
2CCLMMDLSFLDHMLSFAYAGYAPAFM-PINK-LIPSDREAYER
2CCLMMDLSFLDHMLSFAYAGYAPAFM-PINK-LIPSDREAYER
3

20pcs Collagen Crystal Lip Mask Moisturizes Dry Lips, Smooths Fine Lines, Deeply

New Arrival
AED25.99 AED29.99 13%

nudge icon Trending Product

nudge icon Selling out fast

nudge icon 100+ sold recently

nudge icon Free delivery

HLB-05
HLB-05
HLB-05
3

Hudamoji Liquid Blush

New Arrival
AED30.00 AED80.00 63%

nudge icon Trending Product

nudge icon Selling out fast

nudge icon 100+ sold recently

MSL-45
MSL-45
MSL-45
3

Missrose Smirk lipstick

New Arrival
AED5.00 AED30.00 83%

nudge icon Trending Product

nudge icon Selling out fast

nudge icon 100+ sold recently

SKU-6913B724A70EB
SKU-6913B724A70EB
SKU-6913B724A70EB
3

Automatic Electric Makeup Brush Cleaner

New Arrival
AED72.00 AED77.00 6%

nudge icon Trending Product

nudge icon Selling out fast

nudge icon 100+ sold recently

GFTWCFP-01
GFTWCFP-01
GFTWCFP-01
3

Glamorous Face Two Way Cake Face Powder

New Arrival
AED26.00 AED51.00 49%

nudge icon Trending Product

nudge icon Selling out fast

nudge icon 100+ sold recently

MRFCMF-BEIGE3
MRFCMF-BEIGE3
MRFCMF-BEIGE3
3

Miss Rose Full Coverage Matte Foundation

New Arrival
AED55.00 AED85.00 35%

nudge icon Trending Product

nudge icon Selling out fast

nudge icon 100+ sold recently

MRPC2HC-BEIGE3
MRPC2HC-BEIGE3
MRPC2HC-BEIGE3
3

Miss Rose Perfect Cover 24H Hydrating Concealer

New Arrival
AED47.00 AED85.00 45%

nudge icon Trending Product

nudge icon Selling out fast

nudge icon 100+ sold recently

MRFCC-BEIGE3
MRFCC-BEIGE3
MRFCC-BEIGE3
3

Miss Rose Full Coverage Concealer

New Arrival
AED40.00 AED70.00 43%

nudge icon Trending Product

nudge icon Selling out fast

nudge icon 100+ sold recently

MRPNLF-BEIGE3
MRPNLF-BEIGE3
MRPNLF-BEIGE3
3

Miss Rose Purely Natural Liquid Foundation

New Arrival
AED49.00 AED80.00 39%

nudge icon Trending Product

nudge icon Selling out fast

nudge icon 100+ sold recently

SKU-6913B72015331
SKU-6913B72015331
SKU-6913B72015331
3

Eyebrow Trimming Knife With Comb Curved Moon Small Beauty Supplies Gadgets

New Arrival
AED40.00 AED45.00 11%

nudge icon Trending Product

nudge icon Selling out fast

nudge icon 100+ sold recently

Yoovic
Seller Zone
  • Become a Seller
  • Seller Login
  • FBY Profit Calculator
  • Pending Subscription
Start a Conversation
  • About Us
  • Contact Us
  • seller@yoovic.com
  • Support Ticket
Newsletter

Subscribe to get latest updates

All Right Reserved @Yoovic Portal CO 2024

Payment Methods
Terms & Conditions Privacy Policy